Tuesday, January 28, 2020
DI-MS Technique for Analyzing Protein and Peptide Sequences
DI-MS Technique for Analyzing Protein and Peptide Sequences Food Industrial Application DI-MS technique has been widely applied in food industry as it is an easy and high-throughput tool for analyzing protein and peptide sequences, studying the components or structure in food, monitoring the contamination in food. FAB-MS In the study by Terzi, Boyot, Dorsselear, Luu and Trifilieff (1990), the amino acid sequence of a new 6.8 kDa proteolipid from beef heart was determined by employed FAB-MS. The study isolated and purified the 6.8 kDa proteolipid from an acidic methanol/chloroform extract of bovine cardiac muscle, and subsequently analyzed it with the application Cs atom beam of FAB-MS in 1-thioglycerol matrix. The result showed a protonated molecular ion [M+H]+ at m/z 6834.1 and indicated that it have about 60 residues. The 60 residues in the polypeptide were cleaved into three peptide fragments CN1, CN2 and CN3. To characterize these cleavage peptides from amino acid composition, the CN1 and CN2 were ionized using the FAB-MS that performed with Xe atom beam and 1-thioglycerol matrix while the CN3 which also dissolved in 1-thioglycerol was collided by Cs atom beam to produce sample ions. Table 1.0: Chemical mass of cleavage peptides Cleavage peptides Measured mass [M+H]+ [M+Na]+ CN1 1539.0 1560.9 CN2 2100.5 2121.8 CN3 3134.6 From the analysis of the cleavage peptides, the amino acid sequence and peptide fragments of the 6.8 kDa proteolipid were reported as: MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASS 1 CN1 13 14 CN2 31 32 CN3 AAPAHGHH 60 In addition, the FAB-MS technique was applied to determine the structure of the Lycium chinense Miller fruits (Gou-Qi-Zi) in combination with NMR and IR spectroscopy (Chung, Ali, Praveen, Yu, Kim, Ahmad, 2014). L. chinense fruit is a valuable tonic or food, hence there are many researches have been reported to display the properties the L.chinense fruit. For example, the anticancer, antibacterial and antioxidant properties (Lee et al., 2005; Wang, Chang, Inbaraj. Chen, 2010; Zhang et al., 2011) and the antihepatotoxic activity and chemical constituents (Chin et al., 2003; Kim et al., 1997). In the research, the four new compounds (i, ii, iii and iv) that isolated from L. chinense fruits were characterized using the FAB-MS (JMS-700) spectrometer. The antioxidant activity of the four compounds was further studied and it demonstrated that the activity of the compounds followed the order 1423. Table 2.0: Characterization of compound (i) to (iv) Mass Species m/z Detected species Suggestion Compound (i) [M+H]+ 817 C40H65O17 -aromatic acid glycosidic ester 283 [CH3(CH2)16COO]+ -steric acid was esterified with one phenolic group 267 [CH3(CH2)16CO]+ 414 [C15H26O13]+ -three arabinose units bind to one phenolic group 265 [C10H17O8]+ 133 [C5H9O4]+ Compound (ii) [M+H]+ 1165 C50H85O30 -susquiterpene glycoside ester 265 [C10H17O8]+ -few arabinose units bind to the sesquiterpene moiety 223 [C14H27CO]+ 133 [C5H8O5]+ Compound (iii) [M]+ 1309 C58H100O32 -hexaglycoside 341 [C12H21O11]+ -six hexose sugar units bind to each other -unsaturated fatty acid located at terminal position 335 [C21H39COO]+ 325 [C12H21O10]+ 319 [C12H39CO]+ 179 [C6H11O6]+ 163 [C6H11O5]+ Compound (iv) [M+H]+ 841 C31H52O26 -five arabinose units and one glucose unit 661 [C25H41O20]+ -five pentose sugar units bind to a hexose sugar 529 [C25H41O20-C5H8O4]+ 281 [C10H17O9]+ TOF-SIMS TOF-SIMS which widely applied in surface analysis is an important technique for monitoring the contamination in food as the usage of pesticides and fungicide in the agriculture practice will alter and compromise the food quality. The study used TOF-SIMS technique to characterize and compare three different groups of Seggianese olives which classified as untreated (UT), treated with insecticide (dimethoate) and fungicide (copper oxychloride) without washing (TU) and treated with insecticide and fungicide with washing with cold water (TW) (Focardi, et al., 2006). Before measuring the molecular masses of three different groups of olives, the mass calibration was done by using CH3+, C2H3+ and C3H5+ peaks as calibration compounds for positive ions C, CH and C2H peaks as calibration compounds for negative ions. The SIMS data proved the chemical treatments modify the surface composition of olive, resulting in higher intensity signals in TU compared with TW or UT olive spectra. Besides, the intensity of UT and TW olives showed a small variance between each other, demonstrating the washing process was no effective in removing of insecticides and fungicides that will stimulate the composition alterations of olives. Table 3.0: Intensity of few relevant peaks from three different olive samples Peaks Mass peak m/z Attribution Intensity TU olive TW olive UT olive Positive 31.018 CH3O+ 4.23 10-4 6.93 10-5 1.12 10-4 57.074 C4H9+ 1.18 10-2 5.92 10-3 5.08 10-3 73.051 C4H9O+ 7.83 10-4 3.34 10-4 3.08 10-4 147.082 C6H14NOP+ / C6H13NOS+ 2.42 10-4 7.37 10-5 2.93 10-5 Negative 15.994 O 1.13 10-4 2.30 10-3 7.20 10-3 17.002 OH 1.19 10-4 4.42 10-3 5.44 10-3 31.972 S 5.24 10-4 1.99 10-5 1.47 10-5 MALDI-TOF/TOF MS MALDI-MS is a widespread analytical tool for proteins, peptides and oligonucleotides as it offers high ion yields of the intact analyte samples, high sensitivity and accuracy (Lewis, Wei, Siuzdak, 2000). In year 2012, a research about the peptide of peanut hydrolysate has the properties of umami taste had reported by Su, Cui, Zheng, Yang, Ren Zhao. Umami taste is known as the fifth basic taste and it usually described as savory or MSG-like taste. In the study, two novel umami and umami-enhancing peptides were isolated from peanut hydrolysate, purified using chromatography and identified by MALDI-TOF/TOF MS. The analysis of peptides was performed by MALDI-MS equipped with 337nm of UV nitrogen laser and matrix solution as sinapic acid saturated in 0.1% trifluoroacetic acid and acetonitrile. The MALDI-TOF/TOF MS was used to sequence the two novel peptides that termed as P3 and P4 as they produce umami taste. It found that the molecular mass of P3 and P4 was 1091.419 Da and 965.595 Da respectively and the amino sequence of P3 is EGSEAPDGSSR while P4 is SSRDEQSR. Bibliography Chung, I. M., Ali, M., Praveen, N., Yu, B. R., Kim, S. H., Ahmad, A. (2014). New polyglucopyranosyl and polyarabinopyranosyl of fatty acid derivatives from the fruits of Lycium chinense and its antioxidant activity. Food Chemistry, 435-443. Focardi, S., Ristori, S., Mazzuoli, S., Tognazzi, A., Leach-Scampavia, D., Castner, D. G., et al. (2006). ToF-SIMS and PCA studies of Seggianese olives and olive oil. Colloids and Surfaces, 225-232. Lewis, J. K., Wei, J., Siuzdak, G. (2000). Matrix-assited laser desorption/iomization mass spectrometry in peptide and protein analysis. Chichester: John Wiley Sons Ltd. Su, G., Cui, C., Zheng, L., Yang, B., Ren, J., Zhao, M. (2012). Isolation and identification of two novel umami and umami-enhancing peptides from peanut hydrolysate by consecutive chromatography and MALDI-TOF/TOF MS. Food Chemistry, 479-485. Terzi, E., Boyot, P., Dorsselear, A. V., Luu, B., Trifilieff, E. (1990). Isolation and amino acid sequence of a novel 6.8-kDa mitochondrial proteolipid from beef heart. FABS Letters, 122-126. Conclusion In food industry, the analysis of protein and peptide can be performed well by using MALDI-MS and FAB-MS while the application of SIMS is mostly used for detecting the surface of contaminated food. Besides, the structure of the components in foods can also be identified by using the FAB-MS combined with NMR and IR spectroscopies.
Monday, January 20, 2020
brains :: essays research papers
What You Need to Know about Brain TumorsThis thorough article for consumers describes the symptoms, diagnosis, and treatment of brain tumors. IntroductionEach year more than 17,000 people in the United States find out they have a brain tumor. The National Cancer Institute (NCI) has written this booklet to help patients and their families and friends better understand brain tumors. We also hope others will read it to learn more about these tumors.This booklet describes the symptoms, diagnosis, and treatment of brain tumors. We know that booklets cannot answer every question about brain tumors. They cannot take the place of talks with doctors, nurses, and other members of the health care team, but we hope our information will help with these talks.Definitions of words that may be new to readers and other terms related to cancer can be found in the Glossary. For some words, a "sounds-like" spelling is also given.Our knowledge about brain tumors keeps increasing. For up-to-date information or to order this publication, call the NCI-supported Cancer Information Service (CIS) toll free at 1-800-4-CANCER (1-800-422-6237 ).The BrainTogether, the brain and spinal cord form the central nervous system. This complex system is part of everything we do. It controls the things we choose to do -- like walk and talk -- and the things our body does automatically -- like breathe and digest food. The central nervous system is also involved with our senses -- seeing, hearing, touching, tasting, and smelling -- as well as our emotions, thoughts, and memory.The brain is a soft, spongy mass of nerve cells and supportive tissue. It has three major parts: the cerebrum, the cerebellum, and the brain stem. The parts work together, but each has special functions.The cerebrum, the largest part of the brain, fills most of the upper skull. It has two halves called the left and right cerebral hemispheres. The cerebrum uses information from our senses to tell us what is going on around us and tells our body how to respond. The right hemisphere controls the muscles on the left side of the body, and the left hemisphere control s the muscles on the right side of the body.
Sunday, January 12, 2020
Managerment
Do you agree with Vim's employment response to competition from software development contractors in India like Wiper that are expanding into IT consulting services? Why or why not? Vim's strategy appears oriented around ââ¬Å"growing the pie. â⬠If It can Increase Its products' user base by lower costs, It should be able to Increase demand for Its consulting services. However, low-cost consulting groups are ready to fill this void. Therefore, IBM will need to continue Its expansion Into low-cost labor markets.In Dalton, this expansion will need to embrace low cost markets outside of India. These markets Include Russia, China, Indonesia, and Mexico. Will Vim's plan to give away some of Its IT assets and Intellectual property and Increase Its support of open- source software products like Linux be a successful growth strategy In the ââ¬Å"brutally competitive marketplaceâ⬠in which It operates? Why or why not? IBM has expertise in supporting these applications. By lowering licensing costs or aging the software free, IBM should be able to increase its user base.With a broader user base, the demand for support should grow. The strategy appears logical. Of course, other organizations may try to meet this demand, but Vim's low- cost labor sources will help ensure its competitiveness. In addition, low-cost labor will help further increase demand for this software, thereby ensuring growth. However, this strategy will take on a whole new twist as the global economy continues o grow and labor costs rise around the world.History also supports Vim's growth assumptions. Bill Gates found his BASIC interpreter the De facto standard once users found they could easily find free pirated copies. Likewise, the low cost MEMO deals he made for the Windows operating system ensured a user base of over 100 million computers. The computing public values free, high quality software, and many conservative organizations will recognize the MM name as quality assurance. All of th is will encourage growth.
Saturday, January 4, 2020
What You Need to Know About the US Senate
The United States Senate is the upper chamber in the legislative branch ofà the federal government. It is considered to be a more powerful body than the lower chamber, the House of Representatives. The Senate is made up of 100 members called senators. Each state is equally represented two senators, regardless of the stateââ¬â¢s population. Unlike members of the House, who represent individual geographic congressional districts within the states, senators represent the entire state. Senators serve rotating six-year terms and are popularly elected by their constituents. The six-year terms are staggered, with about one-third of the seats up for election every two years. The terms are staggered in such a way that both Senate seats from any state are not contested in the same general election, except when necessary to fill a vacancy. Until enactment of the Seventeenth Amendment in 1913, senators were appointed by the state legislatures, rather than being elected by the people. The Senate conducts its legislative business in the north wing of the U.S. Capitol Building, in Washington, D.C.à Leading the Senate The Vice Presidentà of the United States presides over the Senate and casts the deciding vote in the event of a tie. The Senate leadership also includes president pro tempore who presides in the absence of the vice president, a majority leader who appoints members to lead and serve on various committees, and a minority leader. Both parties ââ¬âmajority and minorityââ¬âalso have a whip who helps marshal senatorsââ¬â¢ votes along party lines. In presiding over the Senate, the vice presidentââ¬â¢s powers are limited by strict rules adopted by the Senate centuries ago. While present in the Senate chambers, the vice president is expected to speak only when ruling on parliamentary questions and when reporting the results of the Electoral College vote in presidential elections. On a day-to-day basis, meetings of the Senate are presided over by the president pro tempore of the Senate or, more typically, by a junior Senator designated on a rotating basis. The Powers of the Senate The Senates power derives from more than just its relatively exclusive membership; it also is granted specific powers in the Constitution. In addition to the many powers granted jointly to both houses of Congress, the Constitution enumerates the role of the upper body specifically in Article I, Section 3. While the House of Representatives has the power to recommend impeachment of a sitting president, vice president or other civic officials such as a judge for high crimes and misdemeanors, as written in the Constitution, the Senate is the sole jury once impeachment goes to trial. With a two-thirds majority, the Senate may thus remove an official from office. Two presidents, Andrew Johnson, and Bill Clinton have been tried; both were acquitted. The President of the United States has the power to negotiate treaties and agreements with other nations, but the Senate must ratify them by a two-thirds vote in order to take effect. This isnt the only way the Senate balances the power of the president. All presidential appointees, including Cabinet members, judicial appointees and ambassadors must be confirmed by the Senate, which can call any nominees to testify before it. The Senate also investigates matters of national interest. There have been special investigations of matters ranging from the Vietnam War to organized crime to the Watergate break-in and subsequent cover-up. The More Deliberate Chamber The Senate is commonly the more deliberative of the two chambers of Congress; theoretically, a debate on the floor may go on indefinitely, and some seem to. Senators may filibuster, or delay further action by the body, by debating it at length; the only way to end a filibuster is through a motion of cloture, which requires the vote of 60 senators. Theà Senate Committee System The Senate, like the House of Representatives, sends bills to committees before bringing them before the full chamber; it also has committees which perform specific non-legislative functions as well. The Senates committees include: agriculture, nutrition, and forestry;appropriations;armed services;banking, housing, and urban affairs;budget;commerce, science, and transportation;energy and natural resources;environment and public works;finance;foreign relations;health, education, labor, and pensions;homeland security and governmental affairs;judiciary;rules and administration;small business and entrepreneurship;and veterans affairs. There are also special committees on aging, ethics, intelligence and Indian affairs; and joint committees with the House of Representatives. The United States Senate Fast Facts The United States Senate is part of the Legislative Branch of government and is made up of 100 members called ââ¬Å"Senators.â⬠Each State is represented by two Senators elected statewide, rather than by voting districts.Senators serve an unlimited number of six-year terms, staggered in a way to prevent both Senators representing a particular state from being up for reelection at the same time.The Senate is presided over by the Vice President of the United States, who as ââ¬Å"president of the Senate,â⬠is allowed to vote on legislation in the event of a tie vote.Along with its own exclusive powers, the Senate shares many of the same constitutional powers granted to the House of Representatives. Phaedra Trethan is a freelance writer who also works as a copy editor for the Camden Courier-Post. She formerly worked for the Philadelphia Inquirer, where she wrote about books, religion, sports, music, films, and restaurants. Updated by Robert Longley
Thursday, December 26, 2019
How to Use the Spanish Pronoun Se
Se is undoubtedly the most versatile of the Spanish pronouns. As you learn Spanish, you will come across se used in a variety of ways, usually meaning one of the -self words of English such as herself or yourself.à Using Se as a Reflexive Pronoun The most common use of se is a reflexive pronoun. Such pronouns indicate that the subject of a verb is also its object. In English, this is usually accomplished by using verbs such as himself or themselves. ââ¬â¹Se is used as the reflexive pronoun for third-person uses (including when usted or ustedes is the subject). Some verbs (as in the final two examples below) can be used reflexively in Spanish even though they arent translated that way in English. Pablo se ve por el espejo. (Pablo sees himself using the mirror.)Los padres no pueden oà rse. (The parents cant hear themselves.)Rebecca se perjudica por fumar. (Rebecca is hurting herself by smoking.)Benjamà n Franklin se levantaba temprano. (Benjamin Franklin got up early.)Se comià ³ los tacos. (He ate up the tacos.) Using Se as the Equivalent of the Passive Voice Although this use of se isnt technically the passive voice, it fulfills the same function. By using se, particularly when discussing inanimate objects, it is possible to indicate an action without indicating who performed the action. Grammatically, such sentences are structured in the same way that sentences using reflexive verbs are. Thus in a literal sense, a sentence such as se venden coches means cars sell themselves. In actuality, however, such a sentence would be the English equivalent of cars are sold or, more loosely translated, cars for sale. Se abren las puertas. (The doors are opened.)Se vendià ³ la computadora. (The computer was sold.)Se perdieron los llaves. (The keys were lost.)Se prohibe fumar. (Smoking is prohibited.) Using Se as a Substitute for Le or Les When the indirect-object pronoun le or les is immediately followed by another pronoun that begins with an l, the le or les is changed to se. This prevents having two pronouns in a row beginning with the l sound. Dà ©selo a ella. (Give it to her.)Se lo dijo a à ©l. (He told it to him.)No se lo voy a dar a ellos. (Im not going to give it to them.) Using the Impersonal Se Se is sometimes used in an impersonal sense with singular verbs to indicate that people in general, or no person in particular, performà the action. When se is used in this way, the sentence follows the same pattern as those in which the main verb is used reflexively, except that there is no subject to the sentence that is explicitly stated. As the examples below show, there are a variety of ways such sentences can be translated to English. Se maneja rà ¡pidamente en Lima. (People drive fast in Lima.)Se puede encontrar cocos en el mercado. (You can find coconuts in the market.)Muchas veces se tiene que estudiar para aprender. (Often you have to study to learn.)No se debe comer con prisa. (One ought not to eat quickly.) A Caution About a Homonym Se shouldnt be confused with sà © (note the accent mark), which is usually the singular first-person present indicative form of saber (to know). Thus sà © usually means I know. Sà © can also be the singular familiar imperative form of ser; in that case it means you be as a command.
Wednesday, December 18, 2019
Computer Network Platforms And Network Operating Systems
Introduction A computer system that allows exchange of information, data and resource between two or more computers is called a computer network. The most common computer network architectures are peer-to-peer, client-server, and virtualisation. As programming and software, advancement has enhanced in the course of recent decades, so have computers turned out to be better at communicating on a network system. Network operating systems are designed primarily to support user administration, security of all resources in the network, system maintenance activities and tasks related with file management (Techopedia, 2016). The aim of this report is to explain different computer network platforms and network operating systems. Peer-to-peer A peer-to-peer network is created when two or more PCs are associated and share resources such as folders, printers, and CD-ROM drives without needing a different server PC. In this network system, a user can access a data or a printer across the network and so it reduces the costs linked with a central server or multiple printers. Characteristics of peer-to-peer network: â⬠¢ Peer-to-peer network allows user to share various resources such as files and printers. â⬠¢ Peer-to-peer network works better for groups of 10 clients or less. â⬠¢ Peer-to-peer network is a decentralized platform. â⬠¢ Peer-to-peer network platform allows computers in the network communicate easily. Peer-to-peer is generally an integrated part of the computerââ¬â¢s operating system.Show MoreRelated Sun Microsystems, Inc. Essay866 Words à |à 4 PagesSun Microsystems, Inc. Sun Microsystems, Inc. is a worldwide provider of products, services and support solutions for building and maintaining network-computing environments. The Company sells scalable computer systems, high-speed microprocessors and high performance software for operating network computing equipment and storage products. The Company also provides support, education and professional services. The Companys products are used for many demanding commercial and technical applicationsRead MoreOperating Systems Analysis Paper999 Words à |à 4 PagesOperating Systems Analysis Paper There are many operating systems that are common on the Internet today. Back when computers could only handle one command at a time, in the 1950 s, was very time consuming. Now, about sixty years later, a computer s operating system can handle many applications at one time while delivering speed and is user friendly. Although there are many Operating Systems that are available, there are onle a few of them that are well knon and is commonly used. Some of theRead MoreEssay on Explain the Purpose of an Operating System1117 Words à |à 5 PagesExplain the purpose of an operating system Process Management A multitasking operating system may give the appearance that a lot of processes are running concurrently/simultaneously, this is not true as only one process can be executing at any one time on a single-core CPU, unless on a multi-core or similar technology. Processes are often called tasks in embedded operating systems. The function of the task or process is something that takes up time, as opposed to memory, which is something thatRead MoreUpgrading The Current Client Operating System Desktops And Laptops911 Words à |à 4 PagesOverview LSDG, the new research and development group, need to upgrade their current client operating system desktops and laptops. They currently have 280 desktops and laptops that are running Windows 7 and 220 desktops and laptops that are running Windows XP. LSDG need a system that will run a Linux operating system and that will access and share resources with the Linx, LLCââ¬â¢s Microsoft Active Directory domain. The domain consists of several Windows Servers 2012 R2 servers that run various servicesRead MoreMobile Operating Systems : An Operating System Essay773 Words à |à 4 PagesMobile Operating Systems Definition A mobile operating system, also called a mobile OS, is an operating system that is specifically designed to run on mobile devices such as mobile phones, smartphones, PDAs, tablet computers and other such devices. The mobile operating system is a software platform consisting of related programs and data. These programs are used to run the applications on the mobile devices. The mobile OS is responsible for managing all the hardware, resources, memory, and optimizesRead MoreImprovements Of The Energy Efficiency For Cloud Computing918 Words à |à 4 PagesUniversity of Waterloo Faculty of Engineering Department of Electrical and Computer Engineering Improvements of the Energy Efficiency for Cloud Computing Self Study Yuhan Wu Department of Electrical and Computer Engineering University of Waterloo Waterloo, Ontario, Canada Introduction Nowadays, with the development of technology, the demand for high speed computing for the computers increases significantly. Cloud computing is the most emphasized Information andRead MoreUsing The Personal Task Management Software On Computers And / Or Smartphones1470 Words à |à 6 Pagespersonal task management software on computers and/or smartphones. As smartphones are used as an alternatives to personal computers, taking notes on smartphones is getting more and more popular [1]. Similar to programs on a personal computer, applications can downloaded and installed on a smartphone. Similar to a personal computer there exists a wide selection of proprietary and open source mobile operating system platforms, out of these smartphone operating systems, the most prominent ones being ApplesRead MoreThe Cloud Of Cloud Computing1483 Words à |à 6 PagesCloud Computing has been one of the greatest concepts of computer access over the last years, but in fact we have been using it for more than ten years and the majority of us takes advantage of this technology in our daily life without realize it. Gmail, Dropox, Facebook, and many social networks are all examples of Cloud Computing solutions. It seems that the Cloud computing has become essential to a generation that is in constant battle to reduce costs and in the same time to provide unlimitedRead MoreExplain The Purpose Of An Operating System937 Words à |à 4 PagesExplain the purpose of an Operating System: Operating Systems manage hardware and provide services for application software; this means that it makes it easier for users to interact with different software and hardware available on the computer. The most common operating systems are Windows, Mac OS X, and Linux. While each OS is different, they all provide a graphical user interface GUI a GUI allows users to click and drag objects with a mouse instead of entering text at a command line. CharacteristicsRead MoreEmerging Technologies in Data Security888 Words à |à 3 PagesTechnologies in Data Security Introduction In creating a network to support 200 employees in a retail business across five stores in the Midwest, several key design criterion need to be considered in addition to specific security strategies for remote telecommuting, office-based and traveling employees. The intent of this paper is to define the hardware, software, networks and people involved in the design and use of the system, in addition to defining the data captured and information products
Tuesday, December 10, 2019
Space and Form in Modern Sculpture
Question: Discuss about theSpace and Form in Modern Sculpture. Answer: Introduction: Sculpture is one of the most interesting parts of art as compared to other forms such as music and dancing. Sculpture refers to the marriage between form and space. This implies that when the form and the space are made in such a manner that they co-join together, it forms a sculpture. Depending on the capacity and the magnitude of the sculptor, the appeal to the eyes of the viewers will be realized. A sculptor is a person who makes sculptures. Space in the world of sculpture refers to the negative area surrounding the positive side of the form. On the other hand, form refers to the model made by the artist portraying a certain dimension. Artists make sculptures as a way of passing certain information to the viewers[1]. Factors to Consider when Sculpting For any form of art to come out in an outstanding and unique way, there are some basics in which the sculptor ought to consider to meet the threshold required by the viewers. One of this is the material choice of making a statue. It should be one which appeals to the public and do not have a scary reflection[2]. This is because it is meant to sell itself to the potential subscribers. Moreover, appealing monuments makes other people feel the urge to join the industry. Secondly, one ought to consider the texture or the language of the space. People are more enticed by products with smooth texture. This is because it gives them a sense of peace especially when going through tough times in life[3]. Thirdly, the sculptor should consider the location between the form and the space. This is due to the fact that good moldings should have a nice blending of the two. Modern day statues are unique as compared to the past forms. This is attributed to the type of make it is used in the current generation. Most of them are thick in nature due to the type of the material used in its production. As the world revolutionized, people became so aggressive and wanted to change taste in all the natures of the world. This also was felt in the monumental world. The present day sculptures are very charismatic and thus appeal to the eyes of the people at first sight. The materials used are very beautiful and most of these figures are erected to pass a specified message. Most of them are being made for environmental conservation intentions, cultural respect and educational purposes. Some figurines in this generation are produced in form of videos. For instance, the Bad Dream House produced by Vito Aconni in the year 1988[4]. Visual Art Post-minimalist art is designed to employ minimalism either as a conceptual or aesthetic reference point. Minimalism is known to be more of artistic tendency and not just a particular movement. Post-minimalist artworks refer to the day to day simple materials and objects that assume a pure and formalist aesthetic. The fact that post-minimalism comprises of disparate and diverse groupings of artists, it is hard sometimes to attempt to enumerate every possible similarities and continuities between them. Some of the minimalist procedures such as subtractive and additive process are common in post-minimalism (only that sometimes are evident in disguised forms)[5]. Post-Minimalism Composition and Approach This refers to a period whereby inclination of the body parts, aspects of conceptual art, process of art and performance developed into cognitive manner. It began its operations in the early 1960s. During this era, many artists emerged who wanted to produce monuments that do not have any close or whatsoever sort of relationship with the traditional sculptures. They reacted to this theoretically and practically by producing in the styles, which endured styles of the last generation. They shared minimalist interest by rejecting the use of industrial materials but solely dependent on the natural resources such as minerals. Most preferred the use of gold and diamonds as they view them as being beautiful and fascinating[6]. However, they failed in ethical concerns since most concentrated on producing statues, which show sexuality of the human beings. This was faced with a lot of criticism especially from religious perspectives. Moreover, the community was displeased and thus led to uprisi ng for change[7]. Additionally, this generation produced figures, which were anti-allusion. This means that most of the materials used were solely the choice of the artist but not in accordance to the norms or the choices of the society. To add on this, products of the post-minimalism generation had a relationship between the site and the sculpture itself. Most were statured in the place where the functionalism of the so statue was based. For example, the status in Rio Brazil, were placed in the sites where the religious practices used to take place. They are still maintained to date due to its great significance to the subsequent generations. Some of the carvings were eccentric and obstructive in nature. Most were produced to scare away people or give them negative view about certain things in nature[8]. Furthermore, some were produced to represent human figures with artistic features of sculpture. This was used to ride it and prove that tradition was very complex and a difficult task in the human ra ce. Despite their great reshuffle in the art industry, they do not represent the cognitive society. This is because the tradition of the human race should be preserved since it is the bond, which keeps us going. Besides, if conservation should be emphasized simply for the reason that is where all this artists received the knowledge of beginning their work of art[9]. Eva Hesses Contribution to Art Eva Hesse is acknowledged as one of the most well-known artists to suffice following the immediate aftermath of the expressionists. Hesse schooled in American abstract commercial design and painting practices. As an expressionist painter, Hesses practice propelled her to increasingly experiment with various industrial materials including fiber glass, rubber, wire, string, and rope. In the spirit of minimalism, Hesse is said to have explored how to suggest a multi varied psychological moods and organic associations as well as proto-feminist concept. Hesse is hailed to be among the first artists of the 1950s to attempt an experiment with the contours of the organic world of nature, and she is also remembered for championing the simplest artistic gestures[10]. Styles, Attempts and Objectives of Art A balanced structure should be the focus of these people. In case of juxtaposing of materials, the monument becomes confusing and therefore makes the concept off track. This will eventually pull down the market of the product. The artiste should ensure that the material are made up of elements such as wooden nails, glue, and a nut in order to bring interlocking together in an inclusive manner[11]. The language of the surface should speak for itself in order to avoid confusing of the viewers. To add on that, the monument builders should also ensure that the tension of the source is in line with their works of art. This helps in countering problems such as fall and the cracking of the erected objects. This will definitely help reduce fatalities as some of these objects are very heavy and made of deadly materials. Hessefor states that the creation of the figures gives the humanity an opportunity to think in a wider range both macro and micro way. This is due to different concepts such p rocess art and body art used by the artistic family in passing out information. Illustratively, the art produced by Anconni in the 1970 by burning of chest hair was a very dangerous expression and confrontation[12]. Conclusion The paper has explored various facets that define and form sculpture. Being an interesting subject, various art writers and creative artists have undertook a careful analysis of the same whereby they have written extensively on what comprises the best art sculpture. According to Smithson, the choice of a painter reflects that of the photographer as taking photo whereas the larger luggage of beautification lies squarely on the sculptor. This is because the responsibility of choosing the materials to make the work to inhibit the expectations of the viewers is theirs. Likewise, they are expected to deliver a certain concept and thus wrong choice will subject them to be viewed at a strayed position during their daily routine. Bibliography ARTE France, and Films Media Group. 2015. The Guggenheim Museum of Bilbao. https://digital.films.com/PortalPlaylists.aspx?aid=13753xtid=65330. Baler, Pablo. 2013. The next thing: art in the twenty-first century. Barron, Stephanie, Lisa Gabrielle Mark, and Alexander Calder. 2013. Calder and abstraction: from avant-garde to iconic. Chilvers, Ian and Glaves-Smith, John,A Dictionary of Modern and Contemporary Art, second edition (Oxford and New York: Oxford University Press, 2009), p. 569.ISBN 0199239665. Curtis, Penelope, and Keith Wilson. 2011. Modern British sculpture. London: Royal Academy of Arts. Duby, Georges, and Jean Luc Daval. 2010. Sculpture. KoÃÅ'Ãâ ln: Taschen. Ebbinghaus, Susanne. 2011. "Superficial? Approaches to painted sculpture". Source. 30 (3). Eva Hesse. 1976 New York; New York University Press / 1992 Da Capo Press, Inc. Lucy R. Lippard. illus. Trade Paper. 251p. Hamill, Sarah. 2015. David Smith in two dimensions: photography and the matter of sculpture. Hassan, Oskar Hasdinor, Shahriman Zainal Abidin, Rafeah Legino, Rusmadiah Anwar, and Muhamad Fairus Kamaruzaman. 2015. International Colloquium of Art and Design Education Research (i-CADER 2014). https://search.ebscohost.com/login.aspx?direct=truescope=sitedb=nlebkdb=nlabkAN=1076501 Lange-Berndt, Petra. 2015. Materiality. Wood, Jon, David Hulks, and Alex Potts. 2012. Modern sculpture reader. Los Angeles: J. Paul Getty Museum.
Subscribe to:
Comments (Atom)