Thursday, August 27, 2020
Mcdonald’s Healthier Happy Meals Essay
So as to effectively roll out these improvements McDonald’s recruited an examination gathering to lead a broad exploration and present them with a practical arrangement. The Research Questions The inquiries the organization needed to investigate to determine this issue was: * How would they be able to make the suppers for the youngsters more beneficial while keeping up the comfort that cheap food is known for? * How would they be able to cut the calories from their current dinners? * How would they be able to make sound food attractive to youngsters? * How would they be able to keep these more beneficial alternatives financially savvy? * What might be the best showcasing technique to dispatch these more beneficial changes? The Hypothesis A theory investigates an assumption or proposed clarification made based on constrained proof as a beginning stage for additional examination (Merriam-Webster, 2013). In the investigation to bring up an issue and discover an answer, the organization needs to confront the inquiry: how might they make the dinners for the youngsters more beneficial while keeping up the accommodation that cheap food is known for? During that time McDonald’s has added a couple new highlights to their menu like a more extensive choice in treats, a worth menu, and select new reviving more advantageous decisions to their cheap food chain. Be that as it may, the inquiry presently is, how might they further cut the calories from these dinners? Truly, McDonald’s has increased a fine regard in the inexpensive food industry for moving up to more advantageous decisions, however now the children menu may require some redoing all alone. On the off chance that the ordinary menu can give more beneficial decision determinations like plates of mixed greens, under 400 calories, and weight watcher endorsed things, what would they be able to do about glad dinners? An answer for giving a more beneficial choice is to offer an increasingly useful feast that children can appreciate. Apple packs, celery sticks, carrots, diminished milk, prepared rather than singed things and more beneficial meat. Those are only several recommendations to an issue that is anything but difficult to fathom. The principle object is to change the world slowly and carefully, and more beneficial living for is the new street to take. The Variables Local social orders are turning out to be more wellbeing still, small voice and searching for more advantageous alternatives when going out to eat. Despite the fact that McDonald’s didn't follow the well known methodology by drawing individuals in using renowned superstars, individuals felt that offering plays with their Happy Meals were unsuitable. The factors in an examination situation are viewed as autonomous (IV) and ward factors (DV). In this exploration situation the free factors are the food and the showcasing system, while the measure of calories and enthusiasm of the youngsters are the reliant factors. Numerous kids were pulled in to McDonald’s Happy Meals for the toy they got with it and this is the thing that their showcasing procedure rotated around. In April 2012, The Time’s discharged the article â€Å"Why we’re eating less cheerful meals†. The article’s principle center was McDonald’s utilization of plays with their Happy Meals and the utilization of a jokester who â€Å"is dead set on the unpleasant strategic attracting kids into McDonald’s, where they’ll be filled out and prepared for a lifetime of normal inexpensive food feasting visits†(Tuttle, 2012, p. 1). Alongside improving their Happy Meals, McDonald’s has additionally changed their advertising procedure. They despite everything offer the toys however it is not, at this point their fundamental point of convergence. Rather they presently show Ronald McDonald messing about, taking an interest in sound exercises and announcing that a more beneficial way of life is a ton of fun.
Saturday, August 22, 2020
World War II USS Essex CV-9
World War II USS Essex CV-9 USS Essex Overview Country: United StatesType: Aircraft CarrierShipyard: Newport News Shipbuilding Drydock CompanyLaid Down: April 28, 1941Launched: July 31, 1942Commissioned: December 31, 1942Fate: Scrapped USS Essex Specifications Relocation: 27,100 tonsLength: 872 ft.Beam: 147 ft., 6 in.Draft: 28 ft., 5 in.Propulsion: 8 Ãâ€"boilers, 4 Ãâ€"Westinghouse outfitted steam turbines, 4 Ãâ€"shaftsSpeed: 33 knotsRange: 20,000 nautical miles at 15 knotsComplement: 2,600 men USS Essex Armament 4 Ãâ€"twin 5 inch 38 bore guns4 Ãâ€"single 5 inch 38 bore guns8 Ãâ€"fourfold 40 mm 56 gauge guns46 Ãâ€"single 20 mm 78 bore weapons Airplane 90-100 airplane Plan Construction Structured during the 1920s and mid 1930s, the US Navys Lexington-and Yorktown-class plane carrying warships were worked to fit in with the restrictions set out by the Washington Naval Treaty. This understanding put limitations on the tonnage of different sorts of warships just as constrained each signatory’s in general tonnage. These kinds of limitations were insisted through the 1930 London Naval Treaty. As worldwide strains expanded, Japan and Italy left the understanding in 1936. With the breakdown of the arrangement framework, the US Navy started building up a structure for another, bigger class of plane carrying warship and one which joined the exercises gained from the Yorktown-class. The subsequent structure was longer and more extensive just as joined a deck-edge lift framework. This had been utilized already on USS Wasp. Notwithstanding conveying a bigger air gathering, the new class had an enormously improved enemy of airplane combat hardware. With the section of the Naval Expansion Act on May 17, 1938, the US Navy pushed ahead with the development of two new transporters. The first, USS Hornet (CV-8), was worked to the Yorktown-class standard while the second, USS Essex (CV-9), was to be built utilizing the new structure. While work immediately initiated on Hornet, Essex and two extra vessels of its group, were not officially requested until July 3, 1940. Appointed to the Newport News Shipbuilding and Drydock Company, development of Essex started on April 28, 1941. With the Japanese assault on Pearl Harbor and the US passage into World War II that December, work escalated on the new bearer. Propelled on July 31, 1942, Essex finished fitting out and entered commission on December 31 with Captain Donald B. Duncan in order. Excursion to the Pacific Subsequent to spending the spring of 1943 directing investigation and preparing travels, Essex left for the Pacific in May. After a short stop at Pearl Harbor, the bearer joined Task Force 16 for assaults against Marcus Island before turning into the leader of Task Force 14. Striking Wake Island and Rabaul that fall, Essex cruised with Task Group 50.3 in November to help in the intrusion of Tarawa. Moving to the Marshalls, it upheld Allied powers during the Battle of Kwajalein in January-February 1944. Later in February, Essex joined Rear Admiral Marc Mitschers Task Force 58. This development mounted a progression of colossally effective assaults against the Japanese safe haven at Truk on February 17-18. Steaming north, Mitschers transporters at that point propelled a few assaults against Guam, Tinian, and Saipan in the Marianas. Finishing this activity, Essex withdrew TF58 and cruised to San Francisco for an update. Quick Carrier Task Force Setting out Air Group Fifteen, drove by future US Navy top-scorer Commander David McCampbell, Essex directed strikes against Marcus and Wake Islands before rejoining TF58, otherwise called the Fast Carrier Task Force, for the attack of the Marianas. Supporting American powers as they assaulted Saipan in mid-June, the transporters airplane participated in the critical Battle of the Philippine Sea on June 19-20. With the finish of the battle in the Marianas, Essex moved south to help in Allied activities against Peleliu in September. In the wake of enduring a tropical storm in October, the bearer mounted assaults on the Okinawa and Formosa before steaming south to give spread to the arrivals on Leyte in the Philippines. Working off the Philippines in late October, Essex took part in the Battle of Leyte Gulf which saw American airplane sink four Japanese transporters. Last Campaigns of World War II Subsequent to renewing at Ulithi, Essex assaulted Manila and different pieces of Luzon in November. On November 25, the transporter supported its first wartime harm when a kamikaze struck the port side of the flight deck. Making fixes, Essex stayed at the front and its airplane directed strikes across Mindoro during December. In January 1945, the transporter upheld Allied arrivals at Lingayen Gulf just as propelled a progression of strikes against Japanese situations in the Philippine Sea including Okinawa, Formosa, Sakishima, and Hong Kong. In February, the Fast Carrier Task Force moved north and assaulted the region around Tokyo before supporting in the intrusion of Iwo Jima. In March, Essex cruised west and started activities to help the arrivals on Okinawa. The bearer stayed on station close to the island until late May. In the wars last weeks, Essex and other American bearers led strikes against the Japanese home islands. With the wars end on September 2, Essex got requests to c ruise for Bremerton, WA. Showing up, the bearer was deactivated and put for possible later use on January 9, 1947. Korean War After a short time for possible later use, Essex started a modernization program to more readily permit it to take the US Navys fly airplane and improve its general viability. This saw the expansion of another flight deck and a modified island. Re-charged on January 16, 1951, Essex started investigation moves off Hawaii before steaming west to partake in the Korean War. Filling in as the leader of Carrier Division 1 and Task Force 77, the bearer appeared the McDonnell F2H Banshee. Leading strikes and bolster missions for United Nations powers, Essexs airplane assaulted over the promontory and as far north as the Yalu River. That September, the bearer supported harmed when one its Banshees collided with other airplane at hand. Coming back to support after brief fixes, Essex directed an aggregate of three visits during the contention. With the finish of the war, it stayed in the locale and participated in the Peace Patrol and clearing of the Tachen Islands. Later Assignments Coming back to Puget Sound Naval Shipyard in 1955, Essex started a monstrous SCB-125 modernization program which incorporated the establishment of a calculated flight deck, lift movements, and establishment of a typhoon bow. Joining the US Pacific Fleet in March 1956, Essex to a great extent worked in American waters until being moved to the Atlantic. After NATO practices in 1958, it redeployed to the Mediterranean with the US Sixth Fleet. That July, ​Essex upheld the US Peace Force in Lebanon. Withdrawing the Mediterranean in mid 1960, the transporter steamed to Rhode Island where it experienced a change to an enemy of submarine fighting help bearer. Through the rest of the year, Essex directed an assortment of preparing missions as the lead of Carrier Division 18 and Antisubmarine Carrier Group 3. The boat likewise partook in NATO and CENTO practices which took it to the Indian Ocean. In April 1961, plain airplane from Essex flew observation and escort missions over Cuba during the bombed Bay of Pigs intrusion. Soon thereafter, the bearer directed an altruism voyage through Europe with port brings in the Netherlands, West Germany, and Scotland. Following a refit at the Brooklyn Navy Yard in 1962, Essex got requests to uphold the maritime isolate of Cuba during the Cuban Missile Crisis. On station for a month, the transporter supported in keeping extra Soviet materials from arriving at the island. The following four years saw the transporter satisfy peacetime obligations. This demonstrated a tranquil period until November 1966, when Essex crashed into the submarine USS Nautilus. In spite of the fact that the two vessels were harmed, they had the option to securely make port. After two years, Essex filled in as the recuperation stage for Apollo 7. Steaming north of Puerto Rico, its helicopters recouped the container just as space travelers Walter M. Schirra, Donn F. Eisele, and R. Walter Cunningham. Progressively old, the US Navy chose to resign Essex in 1969. Decommissioned on June 30, it was expelled from the Navy Vessel Register on June 1, 1973. Quickly held in mothballs, Essex was sold for scrap in 1975. Chosen Sources DANFS: USS Essex (CV-9)USS Essex Association
Friday, August 21, 2020
Blog Archive MBA Admissions Myths Destroyed I Do Not Have to Rework My Resume
Blog Archive MBA Admissions Myths Destroyed I Do Not Have to Rework My Resume Many MBA candidates do not thoroughly consider and revise their resumes for their applications, often dismissing this element because an existing version may already be saved on their computer. We strongly caution you not to underestimate the value of this documentâ€"the admissions committees, in fact, review applicants’ resumes carefully because they serve as a road map of each candidate’s career. In the past, we have highlighted that your resume is not the place to “stuff†all of your life experiences. Somewhere between the two extremesâ€"cramming your resume with information and ignoring it altogetherâ€"lies the ideal: a clear, easily scannable, action-/results-oriented resume that tells a story that will capture the attention of an admissions officer who has reviewed hundreds of similar files. One of the most common errors candidates make is leaving their resume in an industry-specific format, filled with jargon and acronyms recognizable only to an expert in their field. Remember, the admissions committee is not hiring you for a task but is trying to understand your progress, your accomplishments, and even your character. Each bullet point in your resume needs to highlight achievement more than positional expertise. As you prepare your resume to be included in your application, think about your audience, and recognize that your resume can be a strategic tool to reinforce certain characteristics that are important to youâ€"characteristics that may complement information provided in other parts of your application. For example, if you aspire to a career that is international in nature, you may place more emphasis on your international experience in your resume. Or, if you come from a field that is not known for its management orientationâ€"you were a teacher who administered a school’s $50,000 student activities budget, for exampleâ€"you may use your resume to emphasize disciplines that are important to an MBA admissions audience. Some candidates are surprised to realize that one page can communicate so much and therefore deserves a significant level of attention, but investing some time in this short but crucial document is definitely worth the effort. Share ThisTweet Admissions Myths Destroyed Blog Archive MBA Admissions Myths Destroyed I Do Not Have to Rework My Resume Many MBA candidates do not thoroughly consider and revise their resumes for their applications, often dismissing this element because an existing version may already be saved on their computer. We strongly caution you not to underestimate the value of this documentâ€"the admissions committees, in fact, review applicants’ resumes carefully, because they serve as a road map of each candidate’s career. In the past, we have highlighted that your resume is not the place to “stuff†all of your life experiences. Somewhere between the two extremesâ€"cramming your resume with information and ignoring it altogetherâ€"lies the ideal: a clear, easily scannable, action-/results-oriented resume, one that tells a story that will capture the attention of an admissions officer who has reviewed hundreds of similar files. One of the most common errors that candidates make is leaving their resume in an industry-specific format, filled with jargon and acronyms recognizable only to an expert in their field. Remember, the admissions committee is not hiring you for a task, but is trying to understand your progress, your accomplishments, and even your character. Each bullet point in your resume needs to highlight achievement more than positional expertise. As you prepare your resume to be included in your application, think about your audience and recognize that your resume can be a strategic tool to reinforce certain characteristics that are important to youâ€"characteristics that may complement information provided in other parts of your application. For example, if you aspire to a career that is international in nature, you may place more emphasis on your international experience in your resume. Or, if you come from a field that is not known for its management orientationâ€"you were a teacher who administered a school’s $50,000 student activities budget, for exampleâ€"you may use your resume to emphasize disciplines that are important to an MBA admissions audience. Some candidates are surprised to realize that one page can communicate so much and thus deserves a significant level of attention, but investing some time in this short but crucial document is definitely worth the effort. Share ThisTweet Admissions Myths Destroyed
Monday, May 25, 2020
What Disorder / Disorders Were Depicted Essay - 1656 Words
1) Please select one character from the film. What disorder/disorders were depicted? Character: The film A Beautiful Mind is a dramatized biographical telling of the life of renowned man John Nash, a Nobel Prize winner who attended graduate school at Princeton. Disorder(s): In the both real-life and the movie, Nash suffers from schizophrenia. 2) Describe some of this character’s behaviors (2-3) that are indicative of â€Å"abnormality†or â€Å"impairment†(for the individual and/or others). John Nash’s character in the movie suffered from positive, negative, and disorganized symptoms of psychosis, but some played larger roles in his life and were a prominent part of the movie. Perhaps the most debilitating symptom was his hallucinations. One usually thinks hallucinations are just hearing things or occasionally seeing something that is not there, but in the case of Nash, he experienced auditory and visionary hallucinations quite frequently. The director of the film did not directly reveal his hallucinations to be real until halfway through the movie. The main character meets his â€Å"roommate†within the first few scenes, which seems somewhat strange to an audience member, but the actor goes along with it. Charles Herman, the â€Å"roommate†, begins to play a large role in his l ife and is almost always with John. Herman later introduces his niece to Nash, and the pair quickly form a bond. Eventually, the hallucinations are so delusional that he begins to believe a man from the USShow MoreRelatedThe Deer Hunter : Psychological Disorder1262 Words  | 6 Pagespsychological disorder is depicted in the film. This disorder is depicted on the main character of the film. In this film one see clearly what the disorder is and the symptoms that depict that it is indeed a disorder. Following what caused the character to get the disorder. What followed after, once he had the disorder? How it affected the character of the movie and those around him. What changed in his life and if he received any type of treatment because of the disorder. Then finally, what happenedRead MoreDissociative Identity Disorder And The Disorder919 Words  | 4 PagesDisorder and Topic The disorder I chose to research for my paper was Dissociative Identity Disorder. Dissociative Identity Disorder is formerly known as multiple personality disorder and is characterized as an individual presenting two or more alternate personalities. Those said personalities are said to essentially help an individual escape the stress and overwhelming struggles of everyday life (Traub, 2009). As for my topic I chose to explore was whether or not Dissociative Identity DisorderRead MoreMovie Review : A Beautiful Mind 1541 Words  | 7 PagesIn the movie â€Å"A Beautiful Mind†directed by Ron Howard; the disorder that is depicted by the character John Nash is schizophrenia. This brain disorder changes the ordinary mechanisms happening in the brain. The most excellent explanation for this disorder can be spotted to the defective explanations and misfiring of dopamine neurons and their receptors in the brain. Even though there are in additional likely causes and effects for e xample low activity in the front lobotomy and increased ventriclesRead MoreWesternization Vs. Eating Disorders1645 Words  | 7 PagesWesternization Vs. Eating Disorders Historically, through an array of cultures worldwide, individuals have transformed their appearances in order to conform to the beauty ideal of relevant culture. Those that are apart of the Pa Dong Tribe, which reside among the boarder of Thailand, practice the elongating of the neck through the use of brass rings. African and Amazonian tribes consider beauty through the stretching of their lips that is achieved using large lip plates. Tribes in Africa striveRead MorePost Traumatic Stress Disorder Exposed in the Novel 1984, by George Orwell 727 Words  | 3 Pages Post Traumatic Stress Disorder is a mental condition that ails soldiers and civilians alike who have been unfortunate enough to endure terrifying life harrowing experiences. Those who experience this disorder are prone to pejorative flashbacks to the time of the incident that triggered the neurological disorder. Most soldiers are capable of withstanding the withering physiological strain of combat, howe ver a growing portion of people exposed to the graphic belligerence of war areRead MoreSchizophrenia And Its Effects On People922 Words  | 4 PagesSchizophrenia is often depicted in film and media, and because the media has a powerful impact on people, individuals must be careful not to base their views solely on what they see and hear in movies because information may be misrepresented for entertainment purposes. In the films The Soloist and A Beautiful Mind, schizophrenic disorders are illustrated through the protagonists. When comparing these films with scholarly sources, it is apparent that the films appropriately represent the clinicalRead MoreSports Media And Body Image1235 Words  | 5 Pagescorrelation between sports media and women’s body image. The goal of this article was to provide more conclusive research regarding the correlation between disordered eating in college-aged women and media, particularly sports media. Two main theories were incorporated into this article - self-objectification and social comparison theory. Self-objectification refers to the tendency for people to view themselves as others view them, in this instance, the female body and how women view their physical selvesRead More The Medias Influence on Eating Disorders Essay example1100 Words  | 5 PagesThe Medias Influence on Eating Disorders The National Eating Disorders Association states that eating disorders are conditions that arise from factors including physical, psychological, interpersonal, and social issues. Media images help define cultural definitions of beauty and attractiveness and are often acknowledged as one of the factors that contribute to the rise of eating disorders (NEDA). The National Eating Disorders Associations website, The Effect of the Media on Body SatisfactionRead MoreMental Disorders And The United States1370 Words  | 6 PagesMany people completely misunderstand mental disorders and don’t bother trying to correct mistakes made by themselves or others. Depression is no exception. Although it is one of the most common mental disorders categorized in the United States, how is it still such an issue? Although it is so common many people do not recognize the signs in others due to media portrayal, gender stereotypes, and the many misconceptions about this serious mental disorder. People s moods never stay the same, theyRead More How the Media Affects the Self Esteem and Body Image of Young Girls1035 Words  | 5 PagesThe misconception of what is beautiful can be detrimental to young girls. In a television industry attempt to sell goods, they are depicted as sexy. Creating a need for parents to intervene and present a more realistic and normal view of physical beauty. Today, TV presents sexually based images crafted to appeal to young girls. Unfortunately, they are led to believe that their value is only skin deep, causing flawed expectations, illusions, and wrong information about the truth of the physical
Thursday, May 14, 2020
Character Analysis Of 1984 By Winston Smith - 925 Words
War is peace. Freedom is slavery. Ignorance is strength. These are the propagandic catchphrases drilled into the minds of the citizens of the dystopian nation of Oceania in the book 1984 by George Orwell. One of these citizens is Winston Smith, who works in the Ministry Of Truth, altering historical records to coincide with what The Party says. Unlike most people, Winston is aware of the wrongs of the nation they’re living in wants to do something about it. In the book 1984, Winston Smith’s thoughtfulness, rebellious nature, and determination contribute to his character development throughout the novel by helping lead up to his eventual rebellion against The Party. One character trait of Winston Smith is his thoughtfulness. In the book,†¦show more content†¦It is against The Party’s rules to do this, but neither of them care about this. While Julia is in it for the thrill of rebelling, Winston enjoys the intimacy and experience of it, which is something The Party doesn’t want its citizens to feel. In their first time meeting up, Winston exclaims, â€Å"Listen, the more men you’ve had, the more I love you. Do you understand that?†(Orwell 125). Not only is Winston about to take part in the rebellious act of making love to Julia, but he loves her more the more she has rebelled herself. This not only shows that Winston is rebellious, but also that he’s attracted by the rebellious nature of others as well, further cementing his own rebellious nature. This trait aids in his character development by him giving more and more into his rebelliousness and eventually joining the Brotherhood against The Party. If it weren’t for his desire to rebel, he never carry out the act of rebelling, which he gradually got more and more comfortable with thanks to this trait of his. Winston’s rebellious nature is a trait that aids in his character development. One final characteristic of Winston that aids to his c haracter development is his determination. He already displays determination by going against The Party despite knowing the consequences. However, later in the story, this trait shines through evenShow MoreRelatedCharacter Analysis of Winston Smith in 1984 Essay923 Words  | 4 Pagesvictorious. The real hero is flawed, but his courage, selflessness, and sacrifices for the greater good will rise above all. Winston Smith of 1984 is described as a â€Å"small frail figure†with a â€Å"varicose ulcer above his right ankle.†This is evidently not the image conjured when one imagines a hero, but due to the deceiving nature of appearances, we must consider his actions. What does Winston do? He writes â€Å"DOWN WITH BIG BROTHER†repetitively in his diary, he engages in a carnal relationship with a woman heRead More1984 Argument1249 Words  | 5 PagesGeorge Orwell’s book 1984 is a very interesting novel. The novel is set up in Airstrip One. In George Orw ell’s book 1984 it has many situations. One of the many situations are that some people refer society as â€Å"Orwellian.†What does Orwellian mean? Orwellian means, of or related to the works of George Orwell ( especially his picture of his future totalitarian state.) People believe that Orwell is realistic and say his work part of our society now. George Orwell was a writer in the twentieth centuryRead MoreAnalysis Of 1984 By George Orwell954 Words  | 4 PagesSophie Moore Mrs. N. Finley E209R3 – 1984 literary analysis 27 January 2015 Symbolism throughout 1984 The novel 1984 is a futuristic totalitarian society where everyone is kept under close surveillance and is forced to follow all rules and laws of the state. The novel 1984 was written by George Orwell and published in 1950. The main characters were Big Brother, Winston Smith, Julia, O’Brien, Syme and Emmanuel Goldstein. Winston Smith is a low man on the totem pole when it came to the ruling PartyRead More1984 Doublethink Analysis1237 Words  | 5 PagesThe Role of Doublethink in The Government of 1984 â€Å" War is peace. Freedom is slavery. Ignorance is strength,†. The following quote originates from the infamous novel, 1984 by George Orwell. The significance of this popular quote was to display an example of the action of doublethink. Doublethink is the act of having two contradictory thoughts at the same time and believing both are true. Doublethink plays an influential role in the novel, 1984. The novel takes place in a super-state by the nameRead MoreSetting The Standards Of A Genre873 Words  | 4 PagesSetting the Standards of a Genre: An Analysis of 1984 George Orwell’s 1984 depicts a society in which all the people involved are gradually losing all sense of individuality. The novel follows Winston Smith, a member of the outer party in this dystopian society. As an individual, he has been forced to believe the rules of the society he lives in. In Oceania, the country in which he resides, people believe what they are told to believe. Everyone follows the strict beliefs of the party and Big BrotherRead MoreGeorge Orwell s Caged Birds Accept Each Other But Flight Is What They Long For ``1717 Words  | 7 Pagesfor.†In George Orwell’s book 1984 the main character Winston Smith felt like a caged bird and wanted to be free of the totalitarian regime that was Big Brother. In the book, Orwell portrays a society in which life as we know it is none existent. People are stripped of their individualism, programmed like zombies and made to suppress each other. In the book, kids are used to and it would seem with really g ood effect to spy on and monitor the parents and neighbors. Winston defies the regime by thinkingRead MoreA Literary Analysis Of 1984 By George Orwell721 Words  | 3 Pages The essay your about to read is a literary analysis of the book â€Å"1984 by George Orwell†it was written in 1948 as a thriller. Winston Smith is the main character of this story followed by two characters â€Å"Julia and O’Brien.†The book starts off with main character Winston being very frustrated with what is called the â€Å"Party†lead by a man named â€Å"Big Brother†hints the saying â€Å"big brother is watching you†from â€Å"George Orwells worst fear†stated by express.co.uk. the book takes you for a rideRead More1984 Discussion1069 Words  | 5 Pages1984 Discussion Questions 1. The world within which Winston lives is replete with contradictions. For example a, major tenet of the Partys philosophy is that War is Peace. Similarly, the Ministry of Love serves as, what we would consider, a department of war. What role do these contradictions serve on a grand scale? Discuss other contradictions inherent in the Partys philosophy. What role does contradiction serve within the framework of Doublethink? How does Doublethink satisfy the needs of TheRead MoreWinston Smith Character Analysis Essay examples1762 Words  | 8 PagesLiterature 30 August Character Analysis of Winston Smith from 1984 Winston Smith, George Orwell’s main character from 1984, contributes greatly to the novel in many ways. While he is presented to be a simple man, Winston adds many complex ideas to the classic piece of literature. Orwell uses internal and external characteristics, symbols, and significant quotes to develop Winston’s role in 1984. Internal Characteristics are a big part of the development of a main character and ideas relating toRead MoreThe Psychoanalysis of 19841019 Words  | 5 Pagesof 1984 The social structure of George Orwell’s 1984 is based on Freud’s map of the mind and the struggles between the id, the ego and the super ego. The minds of these individuals living in this society are trained to think a certain way. Freud’s theory of psychoanalysis can be applied to Orwell’s 1984. Using Freud’s psychoanalytic approach, 1984’s main character Winston Smith is portrayed as the one who goes against the ideas of the Party. In a Freudian point of view, Winston’s character represents
Wednesday, May 6, 2020
The Great Melting Pot Essay - 2082 Words
There is a nation of individuals who have the great privilege of living in the United States of America. Though, even in its greatness, America has its flaws. As would any other country, no body of people can attain perfection, because perfectionistic standards are simply unrealistic. Often times, the U.S. has been referred to as the ‘great melting pot’. The American culture has grown into a blend of many different ethnicities, lifestyles and beliefs. While this is something to be celebrated, what should be an opportunity for equal representation and distribution of cultures is instead a tendency to rely heavily upon and project a particular agenda (and a powerful one at that). There is not only a racial divide in this country, but the unjustified issue of sexism. While sexism in context applies to both genders, the bulk of the problem leans heavily towards the male treatment of females. In nearly every corner of society, the past and present America has been a society d ominated by men. The Feminists are a select few of many individuals that have stepped forward to re-address the unfair imbalance. Though, just as any other opposition that dares to speak out in contempt against a higher power, their attempts have been labeled as being nothing short of ridiculous. To counteract their activity, this male established position of power has labeled Feminists as incompetent and clearly insane which only gives more justification as to why sexism is alive and thriving. TheShow MoreRelatedAmerica Is The Great Melting Pot1122 Words  | 5 Pages America is the great Melting Pot. From an early age every American is taught that America contains a mixture of the world s cultures in a perfectly blended mixture. We honor and respect all cultures and invite them to bring their customs here to the United States. But do we really? Take for instance, the Hmong refugees who involuntarily moved to America. Cultural Assimilation seemed to be forced down the refugees t hroats. Keeping their native customs was looked on with horror and disgustRead MoreThe Great Melting Pot By Malcom X936 Words  | 4 PagesThe United States is worldwide known as â€Å"The Great Melting Pot†a country that accepts and respects people no matter their race and origin. But in reality, America has been struggling with racism throughout it’s history. Studies show that about half of Americans believe that racism is still a big problem in our society. But despite this, racism has improved over the years. Contemporary America is a better society in terms of discrimination than it was in the 1960’s. In the 60’s racism was so severeRead MoreAmerica s The Great Melting Pot1952 Words  | 8 PagesAmerica the great melting pot. Some have argued that the melting pot analogy is inaccurate. Instead America is like a tossed salad. A person can see all the individual ingredients that make up the salad. People will argue of what can go into a salad an d what cannot go into just as people will argue about the place of certain groups with America. Some find disgust in certain groups of people and praise other. The situation is dynamic. The way people interact with groups are constantly changing andRead MoreRural Health : The Great Melting Pot1793 Words  | 8 Pages Rural Health Toni Partain Stephanie McClenny Alexia McCrary Langston University Rural Health Introduction America’s society is known as the great melting pot; however it is not race that is keeping one sector of society on the outside. Rural America lives on a separate ideology when it comes to economics and health care. One in five people live in a rural community. (Alexia cite) â€Å"The U.S. Census defines rural as â€Å"open country†or towns with fewer than 2,500 inhabitants.†(2010Read MoreImmigrant Influence On Culture And Society1010 Words  | 5 Pages The United States has been called different terms when describing immigration, the most popular term was â€Å"melting pot†, but lately the more politically correct term is â€Å"salad bowl†. The melting pot better describes American society because the cultures have blended together and became more accepting of each other. The history of immigration in the United States has been greatly shaped by immigrant influence on culture and society, the nation’s fluid immigration laws, and how incoming immigrantsRead MoreAmeric The American Dream936 Words  | 4 PagesPeople from other nations come to the United States of America as a sign of change in their lives, but some people don’t agree with all nations are melted into a new race of men, whose labors and future generations will one day cause great change in the world. Many people come to America to live as a new person and in a new life. In the 1770s people from Europe and they had risked their lives just to get to the New World, which was America. They had settled, made homes, they even participated inRead MoreThe Melting Pot By The American Dream Essay1660 Words  | 7 Pages Since the great land of North America had been conquered by the British, it had been called as a big â€Å"melting pot†for many years. Wave after wave of immigrants with different ethnic backgrounds, birthplaces, cultures and heritages moved to this fresh, new land for an identical purpose ---- the divine â€Å"American Dream.†Generations of immigrants who have different faces and skin colors melted and reformed together in this homogenous broth. They cast of their unique cultural identities during theRead MoreCritique of the Theory of Assimilation1583 Words  | 7 Pagesinto the United States (also applies to other countries as well) will have contact with American culture which will generate conflict. These people of a different culture or ethnicity will eventually acculturate and integ rate into a so called â€Å"Melting Pot†of culture in which they will give off their own unique flavor but will eventually blend into mainstream society. I feel that this theory is quite eloquently constructed, but is rather limiting and not necessarily representative of every ethnicRead MoreA Good Example Of The Melting Pot Theory953 Words  | 4 Pagesmarket, they created their own firms and hired new fellow immigrants creating their own labor market. The melting pot theory is â€Å"a metaphor that implies the melting of cultures and intermarriage for ethnicities; a cultural assimilation of immigrants into one new land†(United States Bureau of the Census 1). A good example of the melting pot theory is the country of Colombia; a melting pot of races and ethnicities. The population is derived from three different racial groups: blacks, Native AmericansRead MoreEthical Issues Managers Face in Creating a Diverse Organization786 Words  | 4 Pagestime not long ago we thought of America as a melting pot of cultures and ideologies. That view placed under the light of several generations of struggle for equality no longer holds true. Yes, we are here in the same pot but instead of melting, we have chosen to hold on to our roots, our cultures and ideologies. We wont let go of these so, we are just learning to get along together, and instead of a melting pot we resemble sort of like a delicious pot of stew. We may be a potato, a carrot or scallion
Tuesday, May 5, 2020
Audit and Investment Securities free essay sample
We do not believe that the auditors from Friehling Horowitz exercised due care and maintained professional skepticism throughout the audit. According to the AICPA website, â€Å"due professional care imposes a responsibility upon each professional within an independent auditors organization to observe the standards of field work and reporting†(AICPA). This is because the auditors should have been skeptical of Madoff’s bank account and Chase and should have looked into what that bank account was used for. The auditors should have also been skeptical about how Madoff was able to have a split-strike conversion strategy that he was able to yield â€Å"extraordinary results†. Due care was not exercised by the auditors because they did not perform independent verifications of the revenue, assets, liabilities of the client’s or for the purchase and custody of the securities of the company. The auditors also did not test internal controls which means that they expressed no professional skepticism or due care because they took management’s word for it that these controls were working fine or that they did not feel it necessary to perform audit work in general. We will write a custom essay sample on Audit and Investment Securities or any similar topic specifically for you Do Not WasteYour Time HIRE WRITER Only 13.90 / page As an auditor it is appropriate to obtain sufficient audit evidence with respect to the existence and valuation assertions associated with investments in the form of observable market prices, details of values in the underlying investments or audited financial statements of the alternative investments. The type of evidence that we would like to review to determine whether BLMIS had purchased investment securities would include investment contracts and invoices. The type of evidence that we would like to review to determine whether BLMIS had sold investment securities would include invoices, and confirming transaction in the entity’s account and performing the appropriate reconciliations. The type of evidence that we would like to review to determine whether BLMIS had maintained proper custody of investment securities would include confirmations, security inventory report and examine securities on hand. â€Å"Ordinary negligence is the failure to exercise due professional care, whereas gross negligence is a reckless departure from due care. Gross negligence may be also considered to be constructive fraud. Fraud requires the element of intent to deceive†(Business Forum). The level of failure that was exhibited by Friehling ; Horowitz was all three. They exhibited ordinary negligence by simply not performing the tasks of the audit. They exhibited gross negligence by not performing tasks of the audit, not testing the internal controls and not even looking into the large bank account that all the cash flowed through. Those are major areas that must be addressed in an audit and were completely disregarded by Friehling ; Horowitz. These major areas do represent the possibility of a fraud being committed between the auditors and the company. There is a possibility that there might be small mitigating factors to help defend the actions of the auditing firm but they are really no excuses for why they could not perform their job. If they have taken this engagement on, then they should have performed the specified tasks. We do believe that the auditing firm should be held criminally responsible for a fraud committed by its client’s management team because partners and other management should have been reviewing the auditors’ work and would have noticed that lots of the pieces of the audit were missing. The firm is sending the message that they hire these auditors that do not do thorough work and do not follow up with the proper paper work regarding audit reports and financial statements. It is the firm’s responsibility to perform the audit and by following all standards and when those standards are violated it is the firm who will be held responsible. Friehling should be facing criminal charges because he was not performing a thorough audit and if he had been then he would have been able to see some of the red flags of Bernie Madoff’s scheme. This would have allowed Friehling to uncover the fraud and protect the innocent clients who were losing all their money. Works Cited AICPA. AU Section 230 Due Professional Care in the Performance of Work. November 1972. 4 December 2009 ;http://www. aicpa. org/download/members/div/auditstd/AU-00230. PDF;. Business Forum. Auditors beware: key factors can lead to lawsuits. Summer-Fall 1996. 4 December 2009 ;http://www. entrepreneur. com/tradejournals/article/19104307. html;.
Wednesday, April 8, 2020
Social Acceptance of Ex-Convicts and Finding free essay sample
The hardest aspect of the prison system is the stigmatization that comes after release. This stigmatization against minorities makes re-integration back into society very difficult, especially in the labor market. Large populations of convicts are men and this has a negative effect on the stability of families. Social stigma is one of the common problems which ex-convicts are facing today. This is one of the reasons why they cannot change themselves for the better because of the labels being imposed to them.In other words, social stigma imposed to the ex-convicts hinders their willingness to change for the better because of the bad impression to them and other people thinks that they will not do anything good in the society. These instances would probably result to social exclusion. The process of leaving prison will not be easy for ex-convicts. By simply carrying the â€Å"ex-convict†as a label, they will only be excluded in the society (Visher Travis, 2003). We will write a custom essay sample on Social Acceptance of Ex-Convicts and Finding or any similar topic specifically for you Do Not WasteYour Time HIRE WRITER Only 13.90 / page In our society, it is normal to perceive an ex-convict at first encounter, as violent or harmful individuals.But, people should put in their minds the true essence of imprisonment. As suggested by Giddens (1997), a correctional institution serves as a rehabilitation of the inmates to play active role and to be a proper part of the society after their sentences. (as cited in Nsanze, 2007). With this insight, people might change their perception and attitude towards an ex-convict. Many ex-convicts claimed that they experience continuous exclusion since their release (Nsanze, 2007). There are barriers, from retrieving their family to securing jobs. In addition, there longer the sentence imposed to them, the more likely that an ex-convict like them not be recognized and not to be welcomed in the society, in which they belong previously. In other words, they become eroded and became useless (Pager Manza, 2004). Moreover, Newman (2010) defined another hot button issue for ex-convicts, which is recidivism. Due to the extreme exclusions and the lack of acceptance an ex-convicts experience in a society, the probability of repeating the crimes they committed becomes high.Though there are benefits, programs, and supports that are made and proposed for ex-convicts, still, any of this solves nothing (Digal, 2011). The researchers want to change the conception of the Filipinos about ex-convicts. Ex-convicts are usually being discriminated and being set aside. They are experiencing unfair treatments in fields of education and employment; they may even receive detachment from their own family, and unfair judgments from the society.Social rejection creates frustrations and makes life difficult for ex-convicts. According to Ronquillo (2011) stated that most prisoners become disassociated with their love ones and so they refuse to leave jail because they have no family to come home to. Given this reality, the personal reform that an ex-convict is pursuing becomes difficult and a challenging personal struggle which is not always successful due to lack of opportunities and poverty.By pursuing this study, we make people more aware of the experiences, and sentiments of ex-convicts. We encourage them to open their hearts and minds to help create a social environment where ex-convicts will be accepted and trusted by more people and where they will have a better chance of living a normal, moral and decent life. This study is not for ex-convicts alon e, the researchers also want to tell the prisoners that there is life waiting for them after imprisonment. This study is also for the family member of the ex-convict, professors or teachers to understand the situation of ex-convicts, so that they will be the one to inform the students, and to change the misconception of the society and encourage them to help the ex-convict to build a new life by accepting them. Theoretical Framework This study is supported by the following theoretical concepts: Social Acceptance is defined as a situation in which other people have come to like you, respect you, approve you, and includes you in their groups and relationships (Zimbardo, 1985).
Monday, March 9, 2020
How to Teach Private English Lessons Successfully
How to Teach Private English Lessons Successfully Teaching one-to-one can help improve your teaching salary, and give you some flexibility in scheduling. Of course, teaching one-to-one has its drawbacks as well. Heres a quick rundown on the art of teaching English one-to-one, as well as some strategies and tips to help you get started or improve your one-to-one teaching skills. Before You Get Started Before you begin teaching one-to-one youll need to do a needs analysis to be effective. Performing a needs analysis for a new student can be a simple as having a conversation about what the student would like to cover, or as complicated as asking the student to fill out a questionnaire. However you go about delivering your needs analysis, understand that many students dont necessarily know what their needs are. English learners who havent studied in an academic setting for years might say something along the lines of I need to learn English. and leave it at that. Here are the basic questions and tasks you should ask or perform for a basic English learning needs analysis for one-to-one teaching: Doing a Needs Analysis Have a short conversation in English to warm things up. If you speak the local language you might want to begin in the learners native tongue, but switch to English as soon as possible. This will give you a feel for the basic level. Ask why the English learner wishes to have one-to-one teaching. If she is hesitant, make suggestions: work, travel, general interest in learning the global language of choice, etc. Based on the answer to this question, dig a little deeper. If your one-to-one client wants to learn English for work, ask about specific tasks they need to perform in English (feel free to switch language if you speak it). If the client wants to improve English for travel, find out where they are traveling, what they plan to do there, etc. Ask if theyve studied English before. When was the last time they studied? Have they ever taken a test such as the TOEFL, FCE, etc.? Provide a quick listening and reading comprehension exercise to get a feel for their comprehension skills and vocabulary. If possible use the Internet to fish something out based on their responses to your previous questions. The closer you get to their interests, the better youll understand their true comprehension capabilities. Provide a short writing task if they need English for work or studies. If possible, give them a quick grammar review quiz. Planning One-to-One Lessons Once youve provided a needs analysis, you can decide on specific outcomes for your lessons. State clearly what you expect your one-to-one student will be able to do by the end of your sessions together. Once the student understands the specific goals youve outlined, and agreed to these goals, planning your lessons will become much easier. Make sure these outcomes are specific. Here are some examples: Instead of Improve listening skills: Improve comprehension skills at conferences by focusing on language commonly used in presentations.Instead of Improve grammar: Improve grammar in written communications such as emails and memos. Focus on better use of tenses to describe past situations, etc.Instead of Practice English for travel: Become comfortable with a wide range of expected shopping experiences. The bottom line is that the more specific you can make your lessons to the individual learner, the happier your one-to-one students will be. Eventually, this will lead to lots of referrals. Advantages of One to One English Teaching One-to-one teaching can take place based on your schedule. Youll develop an extensive understanding of tailoring lesson to individual needs. You can also focus on the type of learning that best fits students learning styles (i.e. multiple intelligences are much easier to teach in a one-to-one setting) Referrals - if you do well, people will be asking for you. Most importantly: you can make better earnings than most language schools can offer. Disadvantages of One-to-One English Teaching Students might cancel at the last second. Make sure you create some rules (i.e. cancellations must occur at least 24 hrs before scheduled lessons) that will protect both your time and the goals of the student. Also, you might have to travel all over town if you decide to provide one to one teaching at places of work/home. This may have its own set of costs. One-to-one teaching is illegal in some countries (South Korea, for example) and some schools frown on one-to-one teaching on your own. Learn the rules ahead of time to save yourself a headache!
Saturday, February 22, 2020
Political systems in India Essay Example | Topics and Well Written Essays - 500 words
Political systems in India - Essay Example And, with perhaps the greatest market in the whole of Asia, India would be an obvious target of Nokia Mobile phones ltd. A robust economy, led by able and intelligent men, and a great variety of people with a variety of needs, Nokia would not only be hugely successful, but also would have the added advantage of successful experimentation. Nokia, a Finland based company, initially started out as a pulp industry before emerging as the Telecommunications giant. Named the world's most respected company for production of consumer durables, Nokia is the world's largest cellular phone company, with a global market of 34%, as on Q2 of 2006, and has a net worth of 4.639 billion Euros1. With headquarters in Espoo, Finland, Nokia's R&D facilities are spread out all over the world. The Indian market is best for launching Nokia phones due to a variety of reasons. Firstly, the market is not uniform. The market comprises of different sections of people, who have diverse tastes and needs. Fulfilling all those needs would be a challenge for a cell phone giant like Nokia. Secondly, the Indian market provides excellent grounds for experimentation. The people are always open to new and exciting ideas.
Wednesday, February 5, 2020
What do you understand by globalisation Discuss who- if anybody, is Essay
What do you understand by globalisation Discuss who- if anybody, is benefiting from different aspects - Essay Example The policy changes have opened up borders domestically and internationally hence facilitating the movements of goods and services and causing massive migration across the globe (Johnson, 2002, 428). Many nations have adopted free-market economies thus expanding investment and trading opportunities, as well as expansion of production potential. The advancement in technology is the main driver of globalization and is making people develop the capacity for making informed decisions (Intriligator, 2003, p. 3). The use of information technology and the use of internet have increased the interactions of people through use of mobile phones and the use of social media such as facebook, twitter, YouTube and MySpace among others. The interactions of people have resulted to peace and understanding across the globe. The interaction of people from different cultural backgrounds has improved the way people respond to various issues (Thompson, 2007, p. 1). Different people have enriched their culture by copying positive aspects of the other people’s culture thus improving their living standards. For example, the Western culture has imposed significant changes in the cultures of developing nations in a positive way. The religion of the Western communities has been accepted in the developing countries (Dator, 2006, p. 23). The building styles of the Western countries have been greatly appreciated in other communities and so on. The governments from different nations have benefitted from globalisation because, through the movement of goods and people across nations, the governments are able to increase revenue. Globalisation has resulted to exports and imports of products across the globe (Intriligator, 2003, p. 7). The governments levy custom duties on imports thus increasing the nations’ income. The world nations are able to increase their GDP because they have the opportunity to produce products for sale in other
Tuesday, January 28, 2020
DI-MS Technique for Analyzing Protein and Peptide Sequences
DI-MS Technique for Analyzing Protein and Peptide Sequences Food Industrial Application DI-MS technique has been widely applied in food industry as it is an easy and high-throughput tool for analyzing protein and peptide sequences, studying the components or structure in food, monitoring the contamination in food. FAB-MS In the study by Terzi, Boyot, Dorsselear, Luu and Trifilieff (1990), the amino acid sequence of a new 6.8 kDa proteolipid from beef heart was determined by employed FAB-MS. The study isolated and purified the 6.8 kDa proteolipid from an acidic methanol/chloroform extract of bovine cardiac muscle, and subsequently analyzed it with the application Cs atom beam of FAB-MS in 1-thioglycerol matrix. The result showed a protonated molecular ion [M+H]+ at m/z 6834.1 and indicated that it have about 60 residues. The 60 residues in the polypeptide were cleaved into three peptide fragments CN1, CN2 and CN3. To characterize these cleavage peptides from amino acid composition, the CN1 and CN2 were ionized using the FAB-MS that performed with Xe atom beam and 1-thioglycerol matrix while the CN3 which also dissolved in 1-thioglycerol was collided by Cs atom beam to produce sample ions. Table 1.0: Chemical mass of cleavage peptides Cleavage peptides Measured mass [M+H]+ [M+Na]+ CN1 1539.0 1560.9 CN2 2100.5 2121.8 CN3 3134.6 From the analysis of the cleavage peptides, the amino acid sequence and peptide fragments of the 6.8 kDa proteolipid were reported as: MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASS 1 CN1 13 14 CN2 31 32 CN3 AAPAHGHH 60 In addition, the FAB-MS technique was applied to determine the structure of the Lycium chinense Miller fruits (Gou-Qi-Zi) in combination with NMR and IR spectroscopy (Chung, Ali, Praveen, Yu, Kim, Ahmad, 2014). L. chinense fruit is a valuable tonic or food, hence there are many researches have been reported to display the properties the L.chinense fruit. For example, the anticancer, antibacterial and antioxidant properties (Lee et al., 2005; Wang, Chang, Inbaraj. Chen, 2010; Zhang et al., 2011) and the antihepatotoxic activity and chemical constituents (Chin et al., 2003; Kim et al., 1997). In the research, the four new compounds (i, ii, iii and iv) that isolated from L. chinense fruits were characterized using the FAB-MS (JMS-700) spectrometer. The antioxidant activity of the four compounds was further studied and it demonstrated that the activity of the compounds followed the order 1423. Table 2.0: Characterization of compound (i) to (iv) Mass Species m/z Detected species Suggestion Compound (i) [M+H]+ 817 C40H65O17 -aromatic acid glycosidic ester 283 [CH3(CH2)16COO]+ -steric acid was esterified with one phenolic group 267 [CH3(CH2)16CO]+ 414 [C15H26O13]+ -three arabinose units bind to one phenolic group 265 [C10H17O8]+ 133 [C5H9O4]+ Compound (ii) [M+H]+ 1165 C50H85O30 -susquiterpene glycoside ester 265 [C10H17O8]+ -few arabinose units bind to the sesquiterpene moiety 223 [C14H27CO]+ 133 [C5H8O5]+ Compound (iii) [M]+ 1309 C58H100O32 -hexaglycoside 341 [C12H21O11]+ -six hexose sugar units bind to each other -unsaturated fatty acid located at terminal position 335 [C21H39COO]+ 325 [C12H21O10]+ 319 [C12H39CO]+ 179 [C6H11O6]+ 163 [C6H11O5]+ Compound (iv) [M+H]+ 841 C31H52O26 -five arabinose units and one glucose unit 661 [C25H41O20]+ -five pentose sugar units bind to a hexose sugar 529 [C25H41O20-C5H8O4]+ 281 [C10H17O9]+ TOF-SIMS TOF-SIMS which widely applied in surface analysis is an important technique for monitoring the contamination in food as the usage of pesticides and fungicide in the agriculture practice will alter and compromise the food quality. The study used TOF-SIMS technique to characterize and compare three different groups of Seggianese olives which classified as untreated (UT), treated with insecticide (dimethoate) and fungicide (copper oxychloride) without washing (TU) and treated with insecticide and fungicide with washing with cold water (TW) (Focardi, et al., 2006). Before measuring the molecular masses of three different groups of olives, the mass calibration was done by using CH3+, C2H3+ and C3H5+ peaks as calibration compounds for positive ions C, CH and C2H peaks as calibration compounds for negative ions. The SIMS data proved the chemical treatments modify the surface composition of olive, resulting in higher intensity signals in TU compared with TW or UT olive spectra. Besides, the intensity of UT and TW olives showed a small variance between each other, demonstrating the washing process was no effective in removing of insecticides and fungicides that will stimulate the composition alterations of olives. Table 3.0: Intensity of few relevant peaks from three different olive samples Peaks Mass peak m/z Attribution Intensity TU olive TW olive UT olive Positive 31.018 CH3O+ 4.23 10-4 6.93 10-5 1.12 10-4 57.074 C4H9+ 1.18 10-2 5.92 10-3 5.08 10-3 73.051 C4H9O+ 7.83 10-4 3.34 10-4 3.08 10-4 147.082 C6H14NOP+ / C6H13NOS+ 2.42 10-4 7.37 10-5 2.93 10-5 Negative 15.994 O 1.13 10-4 2.30 10-3 7.20 10-3 17.002 OH 1.19 10-4 4.42 10-3 5.44 10-3 31.972 S 5.24 10-4 1.99 10-5 1.47 10-5 MALDI-TOF/TOF MS MALDI-MS is a widespread analytical tool for proteins, peptides and oligonucleotides as it offers high ion yields of the intact analyte samples, high sensitivity and accuracy (Lewis, Wei, Siuzdak, 2000). In year 2012, a research about the peptide of peanut hydrolysate has the properties of umami taste had reported by Su, Cui, Zheng, Yang, Ren Zhao. Umami taste is known as the fifth basic taste and it usually described as savory or MSG-like taste. In the study, two novel umami and umami-enhancing peptides were isolated from peanut hydrolysate, purified using chromatography and identified by MALDI-TOF/TOF MS. The analysis of peptides was performed by MALDI-MS equipped with 337nm of UV nitrogen laser and matrix solution as sinapic acid saturated in 0.1% trifluoroacetic acid and acetonitrile. The MALDI-TOF/TOF MS was used to sequence the two novel peptides that termed as P3 and P4 as they produce umami taste. It found that the molecular mass of P3 and P4 was 1091.419 Da and 965.595 Da respectively and the amino sequence of P3 is EGSEAPDGSSR while P4 is SSRDEQSR. Bibliography Chung, I. M., Ali, M., Praveen, N., Yu, B. R., Kim, S. H., Ahmad, A. (2014). New polyglucopyranosyl and polyarabinopyranosyl of fatty acid derivatives from the fruits of Lycium chinense and its antioxidant activity. Food Chemistry, 435-443. Focardi, S., Ristori, S., Mazzuoli, S., Tognazzi, A., Leach-Scampavia, D., Castner, D. G., et al. (2006). ToF-SIMS and PCA studies of Seggianese olives and olive oil. Colloids and Surfaces, 225-232. Lewis, J. K., Wei, J., Siuzdak, G. (2000). Matrix-assited laser desorption/iomization mass spectrometry in peptide and protein analysis. Chichester: John Wiley Sons Ltd. Su, G., Cui, C., Zheng, L., Yang, B., Ren, J., Zhao, M. (2012). Isolation and identification of two novel umami and umami-enhancing peptides from peanut hydrolysate by consecutive chromatography and MALDI-TOF/TOF MS. Food Chemistry, 479-485. Terzi, E., Boyot, P., Dorsselear, A. V., Luu, B., Trifilieff, E. (1990). Isolation and amino acid sequence of a novel 6.8-kDa mitochondrial proteolipid from beef heart. FABS Letters, 122-126. Conclusion In food industry, the analysis of protein and peptide can be performed well by using MALDI-MS and FAB-MS while the application of SIMS is mostly used for detecting the surface of contaminated food. Besides, the structure of the components in foods can also be identified by using the FAB-MS combined with NMR and IR spectroscopies.
Monday, January 20, 2020
brains :: essays research papers
What You Need to Know about Brain TumorsThis thorough article for consumers describes the symptoms, diagnosis, and treatment of brain tumors. IntroductionEach year more than 17,000 people in the United States find out they have a brain tumor. The National Cancer Institute (NCI) has written this booklet to help patients and their families and friends better understand brain tumors. We also hope others will read it to learn more about these tumors.This booklet describes the symptoms, diagnosis, and treatment of brain tumors. We know that booklets cannot answer every question about brain tumors. They cannot take the place of talks with doctors, nurses, and other members of the health care team, but we hope our information will help with these talks.Definitions of words that may be new to readers and other terms related to cancer can be found in the Glossary. For some words, a "sounds-like" spelling is also given.Our knowledge about brain tumors keeps increasing. For up-to-date information or to order this publication, call the NCI-supported Cancer Information Service (CIS) toll free at 1-800-4-CANCER (1-800-422-6237 ).The BrainTogether, the brain and spinal cord form the central nervous system. This complex system is part of everything we do. It controls the things we choose to do -- like walk and talk -- and the things our body does automatically -- like breathe and digest food. The central nervous system is also involved with our senses -- seeing, hearing, touching, tasting, and smelling -- as well as our emotions, thoughts, and memory.The brain is a soft, spongy mass of nerve cells and supportive tissue. It has three major parts: the cerebrum, the cerebellum, and the brain stem. The parts work together, but each has special functions.The cerebrum, the largest part of the brain, fills most of the upper skull. It has two halves called the left and right cerebral hemispheres. The cerebrum uses information from our senses to tell us what is going on around us and tells our body how to respond. The right hemisphere controls the muscles on the left side of the body, and the left hemisphere control s the muscles on the right side of the body.
Sunday, January 12, 2020
Managerment
Do you agree with Vim's employment response to competition from software development contractors in India like Wiper that are expanding into IT consulting services? Why or why not? Vim's strategy appears oriented around â€Å"growing the pie. †If It can Increase Its products' user base by lower costs, It should be able to Increase demand for Its consulting services. However, low-cost consulting groups are ready to fill this void. Therefore, IBM will need to continue Its expansion Into low-cost labor markets.In Dalton, this expansion will need to embrace low cost markets outside of India. These markets Include Russia, China, Indonesia, and Mexico. Will Vim's plan to give away some of Its IT assets and Intellectual property and Increase Its support of open- source software products like Linux be a successful growth strategy In the â€Å"brutally competitive marketplace†in which It operates? Why or why not? IBM has expertise in supporting these applications. By lowering licensing costs or aging the software free, IBM should be able to increase its user base.With a broader user base, the demand for support should grow. The strategy appears logical. Of course, other organizations may try to meet this demand, but Vim's low- cost labor sources will help ensure its competitiveness. In addition, low-cost labor will help further increase demand for this software, thereby ensuring growth. However, this strategy will take on a whole new twist as the global economy continues o grow and labor costs rise around the world.History also supports Vim's growth assumptions. Bill Gates found his BASIC interpreter the De facto standard once users found they could easily find free pirated copies. Likewise, the low cost MEMO deals he made for the Windows operating system ensured a user base of over 100 million computers. The computing public values free, high quality software, and many conservative organizations will recognize the MM name as quality assurance. All of th is will encourage growth.
Saturday, January 4, 2020
What You Need to Know About the US Senate
The United States Senate is the upper chamber in the legislative branch of the federal government. It is considered to be a more powerful body than the lower chamber, the House of Representatives. The Senate is made up of 100 members called senators. Each state is equally represented two senators, regardless of the state’s population. Unlike members of the House, who represent individual geographic congressional districts within the states, senators represent the entire state. Senators serve rotating six-year terms and are popularly elected by their constituents. The six-year terms are staggered, with about one-third of the seats up for election every two years. The terms are staggered in such a way that both Senate seats from any state are not contested in the same general election, except when necessary to fill a vacancy. Until enactment of the Seventeenth Amendment in 1913, senators were appointed by the state legislatures, rather than being elected by the people. The Senate conducts its legislative business in the north wing of the U.S. Capitol Building, in Washington, D.C. Leading the Senate The Vice President of the United States presides over the Senate and casts the deciding vote in the event of a tie. The Senate leadership also includes president pro tempore who presides in the absence of the vice president, a majority leader who appoints members to lead and serve on various committees, and a minority leader. Both parties â€â€majority and minorityâ€â€also have a whip who helps marshal senators’ votes along party lines. In presiding over the Senate, the vice president’s powers are limited by strict rules adopted by the Senate centuries ago. While present in the Senate chambers, the vice president is expected to speak only when ruling on parliamentary questions and when reporting the results of the Electoral College vote in presidential elections. On a day-to-day basis, meetings of the Senate are presided over by the president pro tempore of the Senate or, more typically, by a junior Senator designated on a rotating basis. The Powers of the Senate The Senates power derives from more than just its relatively exclusive membership; it also is granted specific powers in the Constitution. In addition to the many powers granted jointly to both houses of Congress, the Constitution enumerates the role of the upper body specifically in Article I, Section 3. While the House of Representatives has the power to recommend impeachment of a sitting president, vice president or other civic officials such as a judge for high crimes and misdemeanors, as written in the Constitution, the Senate is the sole jury once impeachment goes to trial. With a two-thirds majority, the Senate may thus remove an official from office. Two presidents, Andrew Johnson, and Bill Clinton have been tried; both were acquitted. The President of the United States has the power to negotiate treaties and agreements with other nations, but the Senate must ratify them by a two-thirds vote in order to take effect. This isnt the only way the Senate balances the power of the president. All presidential appointees, including Cabinet members, judicial appointees and ambassadors must be confirmed by the Senate, which can call any nominees to testify before it. The Senate also investigates matters of national interest. There have been special investigations of matters ranging from the Vietnam War to organized crime to the Watergate break-in and subsequent cover-up. The More Deliberate Chamber The Senate is commonly the more deliberative of the two chambers of Congress; theoretically, a debate on the floor may go on indefinitely, and some seem to. Senators may filibuster, or delay further action by the body, by debating it at length; the only way to end a filibuster is through a motion of cloture, which requires the vote of 60 senators. The Senate Committee System The Senate, like the House of Representatives, sends bills to committees before bringing them before the full chamber; it also has committees which perform specific non-legislative functions as well. The Senates committees include: agriculture, nutrition, and forestry;appropriations;armed services;banking, housing, and urban affairs;budget;commerce, science, and transportation;energy and natural resources;environment and public works;finance;foreign relations;health, education, labor, and pensions;homeland security and governmental affairs;judiciary;rules and administration;small business and entrepreneurship;and veterans affairs. There are also special committees on aging, ethics, intelligence and Indian affairs; and joint committees with the House of Representatives. The United States Senate Fast Facts The United States Senate is part of the Legislative Branch of government and is made up of 100 members called â€Å"Senators.†Each State is represented by two Senators elected statewide, rather than by voting districts.Senators serve an unlimited number of six-year terms, staggered in a way to prevent both Senators representing a particular state from being up for reelection at the same time.The Senate is presided over by the Vice President of the United States, who as â€Å"president of the Senate,†is allowed to vote on legislation in the event of a tie vote.Along with its own exclusive powers, the Senate shares many of the same constitutional powers granted to the House of Representatives. Phaedra Trethan is a freelance writer who also works as a copy editor for the Camden Courier-Post. She formerly worked for the Philadelphia Inquirer, where she wrote about books, religion, sports, music, films, and restaurants. Updated by Robert Longley
Subscribe to:
Posts (Atom)